Description
Gene Model Namecicar.CDCFrontier.Ca_04638
Micro Synteny Viewcicar.CDCFrontier.Ca_04638
OrganismCicer arietinum_CDCFrontier (chickpea)
Assembly versioncicar.CDCFrontier.gnm1
Gene Model Buildcicar.CDCFrontier.gnm1.ann1
Gene Familylegfed_v1_0.L_YTSKQB
DescriptionUbiquitin-like superfamily protein
Protein domainsG3DSA:3.10.20.90 SSF54236
mRNA and protein identifiers
(also see Sequences tab)
cicar.CDCFrontier.Ca_04638.1

Sequences
Gene Model Namecicar.CDCFrontier.Ca_04638
This gene model has 1 associated mRNAs
mRNA Sequence

cicar.CDCFrontier.Ca_04638.1 sequence

>cicar.CDCFrontier.Ca_04638.1
ATGGCAAAGGGGGAAAGAGCTATGATACACGTTGAAATGGAATCCAGTGC
TAATGTGAATGATTTAAGGAAGTTTCTAGAATGTTACGGAAGCACTTTTC
TGGAAGACAGTGTTTACCTTTTCATTTACAAGCAGTGTGTGATGTGGGAA
AGTAAGTCATTTAAGTGGCACGGGGTTAAAGATGGCGACACCATTCATCT
CTTTGACGTATACGCTACTGGTGATGAATATGCATCGATGGCAAAATCAT
GCTTGTTTGTGGCTGTGTGTATTGTTCGCGAGTAA
back to top
Protein Sequence

cicar.CDCFrontier.Ca_04638.1 sequence

>cicar.CDCFrontier.Ca_04638.1
MAKGERAMIHVEMESSANVNDLRKFLECYGSTFLEDSVYLFIYKQCVMWE
SKSFKWHGVKDGDTIHLFDVYATGDEYASMAKSCLFVAVCIVRE
back to top
Expression
Available datasets: