Description
Gene Model Namemedtr.Medtr5g030920
Micro Synteny Viewmedtr.Medtr5g030920
OrganismMedicago truncatula (barrel medic)
Assembly versionmedtr.A17_HM341.gnm4
Gene Model Buildmedtr.A17_HM341.gnm4.ann1
Gene Familyphytozome_10_2.59087915
Descriptionprotein kinase family protein; IPR011009 (Protein kinase-like domain), IPR013210 (Leucine-rich repeat-containing N-terminal, type 2), IPR013320 (Concanavalin A-like lectin/glucanase, subgroup), IPR024788 (Malectin-like carbohydrate-binding domain), IPR025875 (Leucine rich repeat 4); GO:0004672 (protein kinase activity), GO:0004674 (protein serine/threonine kinase activity), GO:0005524 (ATP binding), GO:0006468 (protein phosphorylation)
Protein domainsG3DSA:1.10.510.10 G3DSA:2.60.120.200 G3DSA:3.30.200.20 G3DSA:3.80.10.10 PF07714 PF08263 PF12799 PF12819 PS00107 PS00108 PS50011 PTHR24420 SM00220 SSF52058 SSF56112
mRNA and protein identifiers
(also see Sequences tab)
medtr.Medtr5g030920.1
medtr.Medtr5g030920.2

Sequences
Gene Model Namemedtr.Medtr5g030920
This gene model has 2 associated mRNAs
mRNA Sequence

medtr.Medtr5g030920.1 sequence

>medtr.Medtr5g030920.1
AAACAATAAGAATAAATAATAATGTTCAACATCATCAATAATAAGAATAA
TAATGTTTAACATCAACAATAAAACTATAGGAAAAAAACATAATCAACTA
TGCATTGTACTAATTCAATCTCTAACTCGTCTTCCATCTCTTTCCTAGCT
ACCTCCTGCAGTTTCCTTTCCAGGCCTAAAGTCAAACACCATATTTTAAC
AATATTCTTTCTTCTACAGCTTTTATACAAGTTCACTATATTATAGGATT
GATCAGGGTTCATTTTTTCTTTCTTTGAAAAATCTCTAAGGGGTGCTGTT
TCCAAGGCAGAGAATGAAATAGAATTCAGAAGAATTTTTATGTTACTATA
AAGGAAAGATGAAAAGTTAGTTAGCATGGATTCAAGTTTGATAACCCTAT
GGGGTAAAATCTCTTTCAGATTATGATGGAGTTACAAGTTATTAGGATAT
TTAGATTGGTTGTGGCATTTGTTCTTTGTTTGTGTATATTTATCAGATCA
GCTTCTTCTGCAACTAAAGGGTTTGAGAGCATAGCATGTTGTGCTGATTC
AAATTACACAGATCCAAAAACCACCCTAACTTATACAACAGATCACATCT
GGTTCTCTGATAAAAGAAGTTGCAGACAAATACCCGAAATTTTGTTTAGC
CACAGAAGCAATAAAAATGTTCGAAAATTTGAAATATATGAAGGAAAGAG
ATGTTATAATTTGCCAACAGTTAAGGATCAAGTATATTTGATAAGGGGCA
TATTTCCCTTTGATAGTTTAAATTCTTCGTTTTATGTTTCGATCGGGGTA
ACAGAACTAGGCGAATTAAGATCGTCTAGGCTCGAGGACTTGGAAATTGA
GGGAGTTTTTAGAGCCACCAAAGACTACATAGATTTCTGCTTATTGAAGG
AGGATGTCAATCCCTTCATTTCTCAGATTGAATTGAGGCCATTACCTGAA
GAATACCTACATGGTTTCGGTACTAGTGTTTTAAAACTGATAAGCAGAAA
CAATCTTGGTGACACAAATGATGATATAAGGTTCCCAGATGACCAAAATG
ATAGAATCTGGAAACGGAAAGAAACTTCAACTCCAACATCTGCCCTTCCA
CTGTCTTTCAATGTCAGCAATGTTGACCTCAAAGACAGTGTCACACCTCC
TCTACAAGTCCTACAAACAGCTCTTACTCACCCTGAGCGATTGGAGTTCG
TCCATGATGGCCTCGAGACCGATGATTATGAATACTCTGTGTTTCTCCAC
TTTCTTGAACTAAATGGCACTGTCAGAGCAGGACAAAGGGTGTTTGACAT
CTATCTAAACAATGAGATTAAAAAGGAGAAATTTGATGTTTTGGCTGGAG
GGTCCAAGAACAGTTACACTGCCTTGAACATTTCAGCAAATGGATCACTC
AATATAACCTTAGTCAAGGCATCTGGATCTGAGTTTGGACCCCTTTTGAA
TGCCTATGAAATCCTGCAGGCACGGTCGTGGATTGAAGAGACCAACCAAA
AAGATTTGGAAGTTATTCAGAAGATGAGAGAAGAACTGCTGCTGCACAAC
CAAGAAAATGAAGCATTGGAGAGTTGGAGTGGAGACCCTTGTATGATTTT
CCCCTGGAAAGGAATAACATGTGATGATTCAACTGGTTCATCTATTATCA
CTAAGCTGGATCTTTCTTCCAATAATCTCAAGGGAGCAATTCCTTCCATT
GTCACTAAGATGACCAATTTACAAATACTGAACCTGAGCCACAACCAGTT
CGATATGTTATTCCCCTCGTTTCCACCGTCCTCCTTGCTGATATCATTGG
ATCTTAGCTACAATGATCTTTCAGGATGGCTTCCAGAATCCATTATCTCA
CTGCCACATTTAAAATCATTATATTTTGGCTGCAATCCATCTATGAGTGA
CGAAGATACAACAAAGTTGAACAGTTCACTAATCAATACAGATTATGGGA
GATGCAAAGCAAAAAAACCAAAGTTTGGACAAGTATTCGTGATTGGAGCT
ATTACAAGTGGATCACTTTTGATTACTTTGGCTGTTGGAATTCTATTTTT
TTGCCGTTATAGACACAAGTCAATTACTTTGGAAGGATTTGGAAAGACCT
ACCCAATGGCAACAAATATAATTTTCTCTTTGCCAAGCAAAGACGATTTC
TTCATAAAGTCTGTATCAGTTAAACCGTTCACTTTGGAGTATATAGAGCA
GGCTACAGAACAGTACAAAACTTTAATAGGTGAAGGAGGATTTGGCTCTG
TTTACAGGGGCACTCTAGACGATGGTCAAGAAGTGGCAGTGAAAGTGCGG
TCATCCACATCAACTCAGGGAACCCGAGAATTTGATAATGAGCTAAACCT
ACTTTCAGCTATACAACATGAGAACCTGGTGCCTCTTCTGGGTTACTGTA
ATGAGTATGATCAACAAATTCTCGTGTATCCTTTCATGTCCAATGGCTCT
TTGCTAGATAGACTATACGGGGAAGCATCAAAGAGAAAAATATTAGACTG
GCCAACTAGACTCTCTATTGCTCTCGGTGCAGCTCGAGGTTTGGCATATC
TTCACACATTTCCAGGACGTTCTGTAATACACAGGGACGTAAAATCGAGC
AATATACTGCTGGATCAGAGCATGTGTGCTAAGGTTGCAGATTTTGGTTT
CTCAAAATATGCTCCTCAGGAAGGAGACAGTTATGTTTCCCTTGAAGTAA
GAGGAACTGCAGGGTATCTGGATCCTGAGTACTACAAAACCCAGCAATTA
TCTGAAAAAAGTGATGTTTTCAGCTTTGGTGTGGTTCTTCTTGAAATTGT
AAGCGGACGGGAACCTCTCAACATAAAGAGACCAAGGATCGAGTGGAGCT
TGGTTGAATGGGCTAAACCATACATAAGAGCATCAAAGGTGGATGAAATT
GTAGATCCTGGCATCAAGGGAGGATATCATGCAGAGGCATTGTGGAGAGT
TGTGGAAGTAGCACTACAATGTCTAGAACCCTACTCAACATATCGGCCAT
GCATGGTTGATATTGTCCGCGAGTTGGAGGATGCTCTCATTATTGAAAAC
AATGCATCTGAATACATGAAATCCATAGACAGCCTTGGAGGATCCAACCG
CTACTCAATTGTTATGGACAAACGGGCGCTGCCTTCAACTACATCTACAG
CAGAATCAACTATCACAACCCAAACCTTGTCACACCCTCAACCGAGATAG
TAAATGGGTCGATGGAATTCTTTTGATTTGTTTTTGATCATTGCTTTAGT
AATATCACATTTTAAATGGTAAAGGAGAAAAATACTACTTCTGATTGTAT
TTCCATCCACTCTATGTTTCTTGAAACTGAATCTCTCTTGCTCAGCCCCA
GTTTTTATGGGTGAAAAGAATAATTTGGGTCAAATGCAAGTGAAACCATA
TGGTGCATAATTTAAAAGCCATATCATATCATTTGCCAAGTCCAAAGTAA
AAATTTCACAAACTAGTTAGATTGCGATTTAGTCTATAGACACTTCAACA
GAGCTATATACACTATGGTTGACTTGCGACTAATTCGCTCAAGCAGGAGG
AACACATATATATGGGAAACACTTGTAGAACTATTTTGTTTATAGAAATG
AAAATATTTTCCGTTTTTAA
back to top
Protein Sequence

medtr.Medtr5g030920.1 sequence

>medtr.Medtr5g030920.1
MMELQVIRIFRLVVAFVLCLCIFIRSASSATKGFESIACCADSNYTDPKT
TLTYTTDHIWFSDKRSCRQIPEILFSHRSNKNVRKFEIYEGKRCYNLPTV
KDQVYLIRGIFPFDSLNSSFYVSIGVTELGELRSSRLEDLEIEGVFRATK
DYIDFCLLKEDVNPFISQIELRPLPEEYLHGFGTSVLKLISRNNLGDTND
DIRFPDDQNDRIWKRKETSTPTSALPLSFNVSNVDLKDSVTPPLQVLQTA
LTHPERLEFVHDGLETDDYEYSVFLHFLELNGTVRAGQRVFDIYLNNEIK
KEKFDVLAGGSKNSYTALNISANGSLNITLVKASGSEFGPLLNAYEILQA
RSWIEETNQKDLEVIQKMREELLLHNQENEALESWSGDPCMIFPWKGITC
DDSTGSSIITKLDLSSNNLKGAIPSIVTKMTNLQILNLSHNQFDMLFPSF
PPSSLLISLDLSYNDLSGWLPESIISLPHLKSLYFGCNPSMSDEDTTKLN
SSLINTDYGRCKAKKPKFGQVFVIGAITSGSLLITLAVGILFFCRYRHKS
ITLEGFGKTYPMATNIIFSLPSKDDFFIKSVSVKPFTLEYIEQATEQYKT
LIGEGGFGSVYRGTLDDGQEVAVKVRSSTSTQGTREFDNELNLLSAIQHE
NLVPLLGYCNEYDQQILVYPFMSNGSLLDRLYGEASKRKILDWPTRLSIA
LGAARGLAYLHTFPGRSVIHRDVKSSNILLDQSMCAKVADFGFSKYAPQE
GDSYVSLEVRGTAGYLDPEYYKTQQLSEKSDVFSFGVVLLEIVSGREPLN
IKRPRIEWSLVEWAKPYIRASKVDEIVDPGIKGGYHAEALWRVVEVALQC
LEPYSTYRPCMVDIVRELEDALIIENNASEYMKSIDSLGGSNRYSIVMDK
RALPSTTSTAESTITTQTLSHPQPR*
back to top
mRNA Sequence

medtr.Medtr5g030920.2 sequence

>medtr.Medtr5g030920.2
TAATGTTTAACATCAACAATAAAACTATAGGAAAAAAACATAATCAACTA
TGCATTGTACTAATTCAATCTCTAACTCGTCTTCCATCTCTTTCCTAGCT
ACCTCCTGCAGTTTCCTTTCCAGGCCTAAAGTCAAACACCATATTTTAAC
AATATTCTTTCTTCTACAGCTTTTATACAAGTTCACTATATTATAGGATT
GATCAGGGTTCATTTTTTCTTTCTTTGAAAAATCTCTAAGGGGTGCTGTT
TCCAAGGCAGAGAATGAAATAGAATTCAGAAGAATTTTTATGTTACTATA
AAGGAAAGATGAAAAGTTAGTTAGCATGGATTCAAGTTTGATAACCCTAT
GGGGTAAAATCTCTTTCAGATTATGATGGAGTTACAAGTTATTAGGATAT
TTAGATTGGTTGTGGCATTTGTTCTTTGTTTGTGTATATTTATCAGATCA
GCTTCTTCTGCAACTAAAGGGTTTGAGAGCATAGCATGTTGTGCTGATTC
AAATTACACAGATCCAAAAACCACCCTAACTTATACAACAGATCACATCT
GGTTCTCTGATAAAAGAAGTTGCAGACAAATACCCGAAATTTTGTTTAGC
CACAGAAGCAATAAAAATGTTCGAAAATTTGAAATATATGAAGGAAAGAG
ATGTTATAATTTGCCAACAGTTAAGGATCAAGTATATTTGATAAGGGGCA
TATTTCCCTTTGATAGTTTAAATTCTTCGTTTTATGTTTCGATCGGGGTA
ACAGAACTAGGCGAATTAAGATCGTCTAGGCTCGAGGACTTGGAAATTGA
GGGAGTTTTTAGAGCCACCAAAGACTACATAGATTTCTGCTTATTGAAGG
AGGATGTCAATCCCTTCATTTCTCAGATTGAATTGAGGCCATTACCTGAA
GAATACCTACATGGTTTCGGTACTAGTGTTTTAAAACTGATAAGCAGAAA
CAATCTTGGTGACACAAATGATGATATAAGGTTCCCAGATGACCAAAATG
ATAGAATCTGGAAACGGAAAGAAACTTCAACTCCAACATCTGCCCTTCCA
CTGTCTTTCAATGTCAGCAATGTTGACCTCAAAGACAGTGTCACACCTCC
TCTACAAGTCCTACAAACAGCTCTTACTCACCCTGAGCGATTGGAGTTCG
TCCATGATGGCCTCGAGACCGATGATTATGAATACTCTGTGTTTCTCCAC
TTTCTTGAACTAAATGGCACTGTCAGAGCAGGACAAAGGGTGTTTGACAT
CTATCTAAACAATGAGATTAAAAAGGAGAAATTTGATGTTTTGGCTGGAG
GGTCCAAGAACAGTTACACTGCCTTGAACATTTCAGCAAATGGATCACTC
AATATAACCTTAGTCAAGGCATCTGGATCTGAGTTTGGACCCCTTTTGAA
TGCCTATGAAATCCTGCAGGCACGGTCGTGGATTGAAGAGACCAACCAAA
AAGATTTGGAAGTTATTCAGAAGATGAGAGAAGAACTGCTGCTGCACAAC
CAAGAAAATGAAGCATTGGAGAGTTGGAGTGGAGACCCTTGTATGATTTT
CCCCTGGAAAGGAATAACATGTGATGATTCAACTGGTTCATCTATTATCA
CTAAGCTGGATCTTTCTTCCAATAATCTCAAGGGAGCAATTCCTTCCATT
GTCACTAAGATGACCAATTTACAAATACTGGATCTTAGCTACAATGATCT
TTCAGGATGGCTTCCAGAATCCATTATCTCACTGCCACATTTAAAATCAT
TATATTTTGGCTGCAATCCATCTATGAGTGACGAAGATACAACAAAGTTG
AACAGTTCACTAATCAATACAGATTATGGGAGATGCAAAGCAAAAAAACC
AAAGTTTGGACAAGTATTCGTGATTGGAGCTATTACAAGTGGATCACTTT
TGATTACTTTGGCTGTTGGAATTCTATTTTTTTGCCGTTATAGACACAAG
TCAATTACTTTGGAAGGATTTGGAAAGACCTACCCAATGGCAACAAATAT
AATTTTCTCTTTGCCAAGCAAAGACGATTTCTTCATAAAGTCTGTATCAG
TTAAACCGTTCACTTTGGAGTATATAGAGCAGGCTACAGAACAGTACAAA
ACTTTAATAGGTGAAGGAGGATTTGGCTCTGTTTACAGGGGCACTCTAGA
CGATGGTCAAGAAGTGGCAGTGAAAGTGCGGTCATCCACATCAACTCAGG
GAACCCGAGAATTTGATAATGAGCTAAACCTACTTTCAGCTATACAACAT
GAGAACCTGGTGCCTCTTCTGGGTTACTGTAATGAGTATGATCAACAAAT
TCTCGTGTATCCTTTCATGTCCAATGGCTCTTTGCTAGATAGACTATACG
GGGAAGCATCAAAGAGAAAAATATTAGACTGGCCAACTAGACTCTCTATT
GCTCTCGGTGCAGCTCGAGGTTTGGCATATCTTCACACATTTCCAGGACG
TTCTGTAATACACAGGGACGTAAAATCGAGCAATATACTGCTGGATCAGA
GCATGTGTGCTAAGGTTGCAGATTTTGGTTTCTCAAAATATGCTCCTCAG
GAAGGAGACAGTTATGTTTCCCTTGAAGTAAGAGGAACTGCAGGGTATCT
GGATCCTGAGTACTACAAAACCCAGCAATTATCTGAAAAAAGTGATGTTT
TCAGCTTTGGTGTGGTTCTTCTTGAAATTGTAAGCGGACGGGAACCTCTC
AACATAAAGAGACCAAGGATCGAGTGGAGCTTGGTTGAATGGGCTAAACC
ATACATAAGAGCATCAAAGGTGGATGAAATTGTAGATCCTGGCATCAAGG
GAGGATATCATGCAGAGGCATTGTGGAGAGTTGTGGAAGTAGCACTACAA
TGTCTAGAACCCTACTCAACATATCGGCCATGCATGGTTGATATTGTCCG
CGAGTTGGAGGATGCTCTCATTATTGAAAACAATGCATCTGAATACATGA
AATCCATAGACAGCCTTGGAGGATCCAACCGCTACTCAATTGTTATGGAC
AAACGGGCGCTGCCTTCAACTACATCTACAGCAGAATCAACTATCACAAC
CCAAACCTTGTCACACCCTCAACCGAGATAGTAAATGGGTCGATGGAATT
CTTTTGATTTGTTTTTGATCATTGCTTTAGTAATATCACATTTTAAATGG
TAAAGGAGAAAAATACTACTTCTGATTGTATTTCCATCCACTCTATGTTT
CTTGAAACTGAATCTCTCTTGCTCAGCCCCAGTTTTTATGGGTGAAAAGA
ATAATTTGGGTCAAATGCAAGTGAAACCATATGGTGCATAATTTAAAAGC
CATATCATATCATTTGCCAAGTCCAAAGTAAAAATTTCACAAACTAGTTA
GATTGCGATTTAGTCTATAGACACTTCAACAGAGCTATATACACTATGGT
TGACTTGCGACTAATTCGCTCAAGCAGGAGGAACACATATATATGGGAAA
CACTTGTAGAACTATTTTGTTTATAGAAATGAAAATATTTTCCGTTTTT
back to top
Protein Sequence

medtr.Medtr5g030920.2 sequence

>medtr.Medtr5g030920.2
MMELQVIRIFRLVVAFVLCLCIFIRSASSATKGFESIACCADSNYTDPKT
TLTYTTDHIWFSDKRSCRQIPEILFSHRSNKNVRKFEIYEGKRCYNLPTV
KDQVYLIRGIFPFDSLNSSFYVSIGVTELGELRSSRLEDLEIEGVFRATK
DYIDFCLLKEDVNPFISQIELRPLPEEYLHGFGTSVLKLISRNNLGDTND
DIRFPDDQNDRIWKRKETSTPTSALPLSFNVSNVDLKDSVTPPLQVLQTA
LTHPERLEFVHDGLETDDYEYSVFLHFLELNGTVRAGQRVFDIYLNNEIK
KEKFDVLAGGSKNSYTALNISANGSLNITLVKASGSEFGPLLNAYEILQA
RSWIEETNQKDLEVIQKMREELLLHNQENEALESWSGDPCMIFPWKGITC
DDSTGSSIITKLDLSSNNLKGAIPSIVTKMTNLQILDLSYNDLSGWLPES
IISLPHLKSLYFGCNPSMSDEDTTKLNSSLINTDYGRCKAKKPKFGQVFV
IGAITSGSLLITLAVGILFFCRYRHKSITLEGFGKTYPMATNIIFSLPSK
DDFFIKSVSVKPFTLEYIEQATEQYKTLIGEGGFGSVYRGTLDDGQEVAV
KVRSSTSTQGTREFDNELNLLSAIQHENLVPLLGYCNEYDQQILVYPFMS
NGSLLDRLYGEASKRKILDWPTRLSIALGAARGLAYLHTFPGRSVIHRDV
KSSNILLDQSMCAKVADFGFSKYAPQEGDSYVSLEVRGTAGYLDPEYYKT
QQLSEKSDVFSFGVVLLEIVSGREPLNIKRPRIEWSLVEWAKPYIRASKV
DEIVDPGIKGGYHAEALWRVVEVALQCLEPYSTYRPCMVDIVRELEDALI
IENNASEYMKSIDSLGGSNRYSIVMDKRALPSTTSTAESTITTQTLSHPQ
PR*
back to top