Description
Gene Model Namephavu.Phvul.001G000100
Micro Synteny Viewphavu.Phvul.001G000100
OrganismPhaseolus vulgaris (common bean)
Assembly versionphavu.G19833.gnm1
Gene Model Buildphavu.G19833.gnm1.ann1
Gene Familylegfed_v1_0.L_6SCN3W
Descriptionuncharacterized protein LOC100789572 isoform X1 [Glycine max]; IPR016197 (Chromo domain-like)
Protein domainsG3DSA:2.40.50.40 PF00385 SSF54160
mRNA and protein identifiers
(also see Sequences tab)
phavu.Phvul.001G000100.1
phavu.Phvul.001G000100.2

Sequences
Gene Model Namephavu.Phvul.001G000100
This gene model has 2 associated mRNAs
mRNA Sequence

phavu.Phvul.001G000100.1 sequence

>phavu.Phvul.001G000100.1
CTTGTTCTTCTTCTTCAGACCGTCTCCTTCCTATGCTCCACTCAGTCTCC
TTCTTCTTCACTGTCAGTCTCGTTCCTCTTTCTCAGTGGTGCTTGTTCTC
AGTCTCGGTCTCACTCTCAGTCTCGTTCAAGTGGTTCGTCTCACTATCTC
GTTCCTCGCTCAAATCCAGTCTCGCTCGTTCTCAGTCTCGTTCTCGCTCA
GTCTCGTTCACGCTCAGTCTCGTTCAATTGGTTCGTTTCACTGACTCGTT
CCTCGCTCAAATCTAGGTACTTGAATCTGTTCTTCAGTATCACAGGCTTC
AAGTTGTTCTTACAATTAGCATTCCGAAGAACCCCTTTTCAAATTGGAGT
GTCAATTTCCGTTATCGTTATGGAATTCCGAAATTTTGACCCAAGACACA
CCGGGGAGTTAGTGAAGCACATGGATAGGAGGAATGAGGTTCTTATGGAA
GCATATAGATCGATGTTCCATGAATTAAGAAAACTTCAGGTAGATGAAAA
AGAACCAGTTGCTCCTGAAGCAATACTGGCAACTAGAGAAGAGCAGCGAA
ATGGAAAGACAATTTCTGAGTGGCTCATCCATTGGAAAGCTCAACCAGTG
GAGAAGGCAACTTGGGAGGCAGCAGAGACTATCAAAGAGAAGTTCCCTTC
CTTCTGCCTCGAGGACAAGGCCGAAACTAGCGAGGGCGGTCTTGATGGTA
ACTCATTACCTATAGTTCTTGCACAACCTACAAGTGAGAAACCTCTTTTG
GTCTACTCTAGGAGGTCCAAGGCCCATGTGCCTGAGACTAGCACAACCTT
CCAGGAATCACTATTGGGGAAAGGGGGGAGTTACTTATAGAAAGGGGAAA
TAAAAGATAATTTTGTATACAGGGAGGGAGAAAAAGAGGAGCTTGGCCCT
TATTTTTTTGTAATTTCTTCGAATTCTATTTACAGTAATACAATTCCATT
TCAGATAGGAATAGTTCCTTTCATTGGCCATAGATGGAAGGAAATAGAGG
TACTGTTATGAGTTATATACAAAGGAAGTTGGGAAAAAGGCATACAGCTT
TGTTTTGAATTCTAAGATGTGACTGAGGAGTTCTCTAAATGTGGACGAGG
AATTACTGTTAAGTAAGCAGTTAAGAACAAATGGCCTCTGTCTTTTTGTG
TAAGCTATTTTTCACCAAATTCTAGCAATATTTCAATCAACAGCTTTTGA
TGCATAAAATTCCCATTAAATCTTTTCAACAAGTTTTATAACCAG
back to top
Protein Sequence

phavu.Phvul.001G000100.1 sequence

>phavu.Phvul.001G000100.1
MEFRNFDPRHTGELVKHMDRRNEVLMEAYRSMFHELRKLQVDEKEPVAPE
AILATREEQRNGKTISEWLIHWKAQPVEKATWEAAETIKEKFPSFCLEDK
AETSEGGLDGNSLPIVLAQPTSEKPLLVYSRRSKAHVPETSTTFQESLLG
KGGSYL*
back to top
mRNA Sequence

phavu.Phvul.001G000100.2 sequence

>phavu.Phvul.001G000100.2
CTTGTTCTTCTTCTTCAGACCGTCTCCTTCCTATGCTCCACTCAGTCTCC
TTCTTCTTCACTGTCAGTCTCGTTCCTCTTTCTCAGTGGTGCTTGTTCTC
AGTCTCGGTCTCACTCTCAGTCTCGTTCAAGTGGTTCGTCTCACTATCTC
GTTCCTCGCTCAAATCCAGTCTCGCTCGTTCTCAGTCTCGTTCTCGCTCA
GTCTCGTTCACGCTCAGTCTCGTTCAATTGGTTCGTTTCACTGACTCGTT
CCTCGCTCAAATCTAGGTACTTGAATCTGTTCTTCAGTATCACAGGCTTC
AAGTTGTTCTTACAATTAGCATTCCGAAGAACCCCTTTTCAAATTGGAGT
GTCAATTTCCGTTATCGTTATGGAATTCCGAAATTTTGACCCAAGACACA
CCGGGGAGTTAGTGAAGCACATGGATAGGAGGAATGAGGTTCTTATGGAA
GCATATAGATCGATGTTCCATGAATTAAGAAAACTTCAGGTAGATGAAAA
AGAACCAGTTGCTCCTGAAGCAATACTGGCAACTAGAGAAGAGCAGCGAA
ATGGAAAGACAATTTCTGAGTGGCTCATCCATTGGAAAGCTCAACCAGTG
GAGAAGGCAACTTGGGAGGCAGCAGAGACTATCAAAGAGAAGTTCCCTTC
CTTCTGCCTCGAGGACAAGGCCGAAACTAGCGAGGGCGGTCTTGATGGTG
GACGAGGAATTACTGTTAAGTAAGCAGTTAAGAACAAATGGCCTCTGTCT
TTTTGTGTAAGCTATTTTTCACCAAATTCTAGCAATATTTCAATCAACAG
CTTTTGATGCATAAAATTCCCATTAAATCTTTTCAACAAGTTTTATAACC
AG
back to top
Protein Sequence

phavu.Phvul.001G000100.2 sequence

>phavu.Phvul.001G000100.2
MEFRNFDPRHTGELVKHMDRRNEVLMEAYRSMFHELRKLQVDEKEPVAPE
AILATREEQRNGKTISEWLIHWKAQPVEKATWEAAETIKEKFPSFCLEDK
AETSEGGLDGGRGITVK*
back to top
Expression
Available datasets: